Recombinant Human ZNF607 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96SK3

Gene Name: ZNF607

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 56%

Start Site: Glu341

End Site: Pro420

Coverage: 0.12

Isoelectric Point: 9

Core Sequence: ENGEAFSSGHQLTAPHTFESVEKPYKCEECGKAFSVHGRLTRHQGIHSGKKPYECNKCGKSFRLNSSLKIHQNIHTGEKP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 56%, Rat - 58%, Pig - 62%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 607

Protein name: zinc finger protein 607

Full length: 696 amino acids

Entry name: ZN607_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3596-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3596-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 84775