Recombinant Human ZNF611 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N823

Gene Name: ZNF611

Expression System: Escherichia coli

Molecular Weight: 28.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 30%

Start Site: Lys11

End Site: Phe240

Coverage: 0.34

Isoelectric Point: 7.5

Core Sequence: KGKEPGMALPQGRLTFRDVAIEFSLAEWKCLNPSQRALYREVMLENYRNLEAVDISSKCMMKEVLSTGQGNTEVIHTGTLQRHESHHIGDFCFQEIEKEIHDIEFQCQEDERNGLEAPMTKIKKLTGSTDQHDHRHAGNKPIKDQLGSSFYSHLPELHIFQIKGEIGNQLEKSTNDAPSVSTFQRISCRPQTQISNNYGNNPLNSSLLPQKQEVHMREKSFQCNKSGKAF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 30%, Rat - 43%, Pig - 41%, Cynomolgus monkey - 83%

Alternative gene names: /

Alternative protein names: Zinc finger protein 611

Protein name: zinc finger protein 611

Full length: 705 amino acids

Entry name: ZN611_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3598-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3598-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 81856