Recombinant Human ZNF613 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6PF04

Gene Name: ZNF613

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 61%

Start Site: Ile151

End Site: Tyr260

Coverage: 0.19

Isoelectric Point: 8.5

Core Sequence: IKNSVGVNGDGKSFLHAKHEQFHNEMNFPEGGNSVNTNSQFIKHQRTQNIDKPHVCTECGKAFLKKSRLIYHQRVHTGEKPHGCSICGKAFSRKSGLTEHQRNHTGEKPY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 61%, Rat - 61%, Pig - 76%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Zinc finger protein 613

Protein name: zinc finger protein 613

Full length: 617 amino acids

Entry name: ZN613_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3600-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3600-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 79898