Recombinant Human ZNF615 Protein

Recombinant Human ZNF615 Protein
SKU
ASBPP-3601-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8N8J6

Gene Name: ZNF615

Expression System: Escherichia coli

Molecular Weight: 28 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 31%

Start Site: Glu11

End Site: Lys230

Coverage: 0.31

Isoelectric Point: 7

Core Sequence: EDVAVDFTWEEWQFLSPAQKDLYRDVMLENYSNLVAVGYQASKPDALSKLERGEETCTTEDEIYSRICSEIRKIDDPLQHHLQNQSIQKSVKQCHEQNMFGNIVNQNKGHFLLKQDCDTFDLHEKPLKSNLSFENQKRSSGLKNSAEFNRDGKSLFHANHKQFYTEMKFPAIAKPINKSQFIKQQRTHNIENAHVCSECGKAFLKLSQFIDHQRVHTGEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 31%, Rat - 33%, Pig - 62%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Zinc finger protein 615

Protein name: zinc finger protein 615

Full length: 731 amino acids

Entry name: ZN615_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3601-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3601-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 284370
Product information (PDF)
×
MSDS (PDF)
×