Recombinant Human ZNF616 Protein

Recombinant Human ZNF616 Protein
SKU
ASBPP-3602-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q08AN1

Gene Name: ZNF616

Expression System: Escherichia coli

Molecular Weight: 29 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 36%

Start Site: Asp11

End Site: Ser240

Coverage: 0.30

Isoelectric Point: 7

Core Sequence: DVAIEFSQEEWKCLEPVQKALYKDVMLENYRNLVFLGISPKCVIKELPPTENSNTGERFQTVALERHQSYDIENLYFREIQKHLHDLEFQWKDGETNDKEVPVPHENNLTGKRDQHSQGDVENNHIENQLTSNFESRLAELQKVQTEGRLYECNETEKTGNNGCLVSPHIREKTYVCNECGKAFKASSSLINHQRIHTTEKPYKCNECGKAFHRASLLTVHKVVHTRGKS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 36%, Rat - 35%, Pig - 40%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Zinc finger protein 616

Protein name: zinc finger protein 616

Full length: 781 amino acids

Entry name: ZN616_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3602-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3602-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 90317
Product information (PDF)
×
MSDS (PDF)
×