Recombinant Human ZNF618 Protein

Recombinant Human ZNF618 Protein
SKU
ASBPP-3603-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q5T7W0

Gene Name: ZNF618

Expression System: Escherichia coli

Molecular Weight: 41 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Arg31

End Site: Glu380

Coverage: 0.37

Isoelectric Point: 7

Core Sequence: RSQKSTKVEGPEPVPAEASLSAEQGTMTEVKVKTELPDDYIQEVIWQGEAKEEKKAVSKDGTSDVPAEICVVIGGVRNQQTLDGKAPEGSPHGGSVRSRYSGTWIFDQALRYASGSYECGICGKKYKYYNCFQTHVRAHRDTEATSGEGASQSNNFRYTCDICGKKYKYYSCFQEHRDLHAVDVFSVEGAPENRADPFDQGVVATDEVKEEPPEPFQKIGPKTGNYTCEFCGKQYKYYTPYQEHVALHAPISTAPGWEPPDDPDTGSECSHPEVSPSPRFVAAKTQTNQSGKKAPASVVRCATLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 27%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1952

Alternative protein names: Zinc finger protein 618

Protein name: zinc finger protein 618

Full length: 954 amino acids

Entry name: ZN618_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3603-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3603-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 114991
Product information (PDF)
×
MSDS (PDF)
×