Recombinant Human ZNF618 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5T7W0

Gene Name: ZNF618

Expression System: Escherichia coli

Molecular Weight: 41 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Arg31

End Site: Glu380

Coverage: 0.37

Isoelectric Point: 7

Core Sequence: RSQKSTKVEGPEPVPAEASLSAEQGTMTEVKVKTELPDDYIQEVIWQGEAKEEKKAVSKDGTSDVPAEICVVIGGVRNQQTLDGKAPEGSPHGGSVRSRYSGTWIFDQALRYASGSYECGICGKKYKYYNCFQTHVRAHRDTEATSGEGASQSNNFRYTCDICGKKYKYYSCFQEHRDLHAVDVFSVEGAPENRADPFDQGVVATDEVKEEPPEPFQKIGPKTGNYTCEFCGKQYKYYTPYQEHVALHAPISTAPGWEPPDDPDTGSECSHPEVSPSPRFVAAKTQTNQSGKKAPASVVRCATLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 27%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1952

Alternative protein names: Zinc finger protein 618

Protein name: zinc finger protein 618

Full length: 954 amino acids

Entry name: ZN618_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3603-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3603-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 114991