Recombinant Human ZNF626 Protein

Recombinant Human ZNF626 Protein
SKU
ASBPP-3607-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q68DY1

Gene Name: ZNF626

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Tyr201

End Site: Leu300

Coverage: 0.20

Isoelectric Point: 9.5

Core Sequence: YKCEECGKAFNHSCSLTRHKKIHTGEKPYKCEECGKAFKHSSTLTTHKRNHTGEKPYKCDKCGKAFMSSSTLSKHEIIHTEKKPYKCEECGKAFNRSSTL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Rat - 64%, Pig - 64%, Cynomolgus monkey - 79%

Alternative gene names: /

Alternative protein names: Zinc finger protein 626

Protein name: zinc finger protein 626

Full length: 528 amino acids

Entry name: ZN626_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3607-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3607-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 199777
Product information (PDF)
×
MSDS (PDF)
×