Recombinant Human ZNF627 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q7L945

Gene Name: ZNF627

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 38%

Start Site: Val11

End Site: Val180

Coverage: 0.39

Isoelectric Point: 6.5

Core Sequence: VNFTLEEWALLDPSQKNLYRDVMRETFRNLASVGKQWEDQNIEDPFKIPRRNISHIPERLCESKEGGQGEETFSQIPDGILNKKTPGVKPCESSVCGEVGMGPSSLNRHIRDHTGREPNEYQEYGKKSYTRNQCGRALSYHRSFPVRERTHPGGKPYDCKECGETFISLV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 38%, Rat - 32%, Pig - 62%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Zinc finger protein 627

Protein name: zinc finger protein 627

Full length: 461 amino acids

Entry name: ZN627_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3608-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3608-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 199692