Recombinant Human ZNF630 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q2M218

Gene Name: ZNF630

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 39%

Start Site: Glu11

End Site: Lys160

Coverage: 0.23

Isoelectric Point: 6

Core Sequence: EDVAVDFTQEEWQQLNPAQKTLHRDVMLETYNHLVSVGCSGIKPDVIFKLEHGKDPWIIESELSRWIYPDRVKGLESSQQIISGELLFQREILERAPKDNSLYSVLKIWHIDNQMDRYQGNQDRVLRQVTVISRETLTDEMGSKYSAFGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 39%, Rat - 64%, Pig - 73%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Zinc finger protein 630

Protein name: zinc finger protein 630

Full length: 657 amino acids

Entry name: ZN630_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3628-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3628-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 57232