Recombinant Human ZNF644 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H582

Gene Name: ZNF644

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Leu161

End Site: Tyr340

Coverage: 0.14

Isoelectric Point: 6

Core Sequence: LQLSTPQKASQHQVLFLLSDVAHAKNPTHSNKKLPTSASVGCDIQNSVGSNIKSDGTLINQVEVGEDGEDLLVKDDCVNTVTGISSGTDGFRSENDTNWDPQKEFIQFLMTNEETVDKAPPHSKIGLEKKRKRKMDVSKITRYTEDCFSDSNCVPNKSKMQEVDFLEQNEELQAVDSQKY

Homologies: Highest protein sequence identity to the following orthologs: Pig - 85%, Cynomolgus monkey - 99%

Alternative gene names: KIAA1221; ZEP2

Alternative protein names: Zinc finger protein 644; Zinc finger motif enhancer-binding protein 2; Zep-2

Protein name: zinc finger protein 644

Full length: 1327 amino acids

Entry name: ZN644_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10432-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10432-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 84146