Recombinant Human ZNF646 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O15015

Gene Name: ZNF646

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 78%

Start Site: Lys1151

End Site: Asn1220

Coverage: 0.04

Isoelectric Point: 5.5

Core Sequence: KLQEELKVEPLEEVARVKEEVWEETTVKGEEIEPRLETAEKGCQTEASSERPFSCEVCGRSYKHAGSLIN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Pig - 79%, Cynomolgus monkey - 98%

Alternative gene names: KIAA0296

Alternative protein names: Zinc finger protein 646

Protein name: zinc finger protein 646

Full length: 1832 amino acids

Entry name: ZN646_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3481-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3481-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 9726