Recombinant Human ZNF658B Protein

Recombinant Human ZNF658B Protein
SKU
ASBPP-3516-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q4V348

Gene Name: ZNF658B

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 51%

Start Site: Gln211

End Site: Thr290

Coverage: 0.10

Isoelectric Point: 8.5

Core Sequence: QNSNLSKHLRIHTKEKPCDNNGCGRSYKSPLIGHQKTDAEMELCGGSEYGKTSHLKGHQRILMGEKPYECIECGKTFSKT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 51%, Rat - 51%, Pig - 52%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Zinc finger protein 658B

Protein name: zinc finger protein 658B (pseudogene)

Full length: 819 amino acids

Entry name: Z658B_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3516-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3516-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 401509
Product information (PDF)
×
MSDS (PDF)
×