Recombinant Human ZNF667 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5HYK9

Gene Name: ZNF667

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Glu91

End Site: Lys170

Coverage: 0.14

Isoelectric Point: 10.5

Core Sequence: ETKKLPPNQCNKSGQSICQKLVSAQQKAPTRKSGCNKNSVLVKPKKGHSGKKPLKCNDCGKTFSRSFSLKLHQNIHTGEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 71%, Pig - 80%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Zinc finger protein 667

Protein name: zinc finger protein 667

Full length: 610 amino acids

Entry name: ZN667_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3406-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3406-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 63934