Recombinant Human ZNF667 Protein

Recombinant Human ZNF667 Protein
SKU
ASBPP-3406-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q5HYK9

Gene Name: ZNF667

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Glu91

End Site: Lys170

Coverage: 0.14

Isoelectric Point: 10.5

Core Sequence: ETKKLPPNQCNKSGQSICQKLVSAQQKAPTRKSGCNKNSVLVKPKKGHSGKKPLKCNDCGKTFSRSFSLKLHQNIHTGEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 71%, Pig - 80%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Zinc finger protein 667

Protein name: zinc finger protein 667

Full length: 610 amino acids

Entry name: ZN667_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3406-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3406-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 63934
Product information (PDF)
×
MSDS (PDF)
×