Recombinant Human ZNF669 Protein

Recombinant Human ZNF669 Protein
SKU
ASBPP-3629-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96BR6

Gene Name: ZNF669

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 47%

Start Site: Ala91

End Site: Glu180

Coverage: 0.20

Isoelectric Point: 5

Core Sequence: AFEDVAVNFTQEEWALLDSSQKNLYREVMQETCRNLASVGSQWKDQNIEDHFEKPGKDIRNHIVQRLCESKEDGQYGEVVSQIPNLDLNE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 47%, Rat - 52%, Pig - 60%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Zinc finger protein 669

Protein name: zinc finger protein 669

Full length: 464 amino acids

Entry name: ZN669_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3629-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3629-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 79862
Product information (PDF)
×
MSDS (PDF)
×