Recombinant Human ZNF670 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BS34

Gene Name: ZNF670

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 45%

Start Site: Val11

End Site: Leu140

Coverage: 0.37

Isoelectric Point: 6.5

Core Sequence: VAFTQEEWALLDPSQKNLYRDVMQEIFRNLASVGNKSEDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVSTGVKPCECSVCGKVFICHSALHRHILSHIGNKLFECEECPEKL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 45%, Rat - 31%, Pig - 63%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 670

Protein name: zinc finger protein 670

Full length: 389 amino acids

Entry name: ZN670_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3442-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3442-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 93474