Recombinant Human ZNF672 Protein

Recombinant Human ZNF672 Protein
SKU
ASBPP-3476-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q499Z4

Gene Name: ZNF672

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Thr191

End Site: Lys290

Coverage: 0.25

Isoelectric Point: 9

Core Sequence: TRPRVSDAHQCGVCGKCFGKSSTLTRHLQTHSGEKPFKCPECGKGFLESATLVRHQRTHTGEKPYACGDCGRCFSESSTLLRHRRSHQGERPHACATCGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 84%, Pig - 87%, Cynomolgus monkey - 56%

Alternative gene names: /

Alternative protein names: Zinc finger protein 672

Protein name: zinc finger protein 672

Full length: 452 amino acids

Entry name: ZN672_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3476-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3476-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 79894
Product information (PDF)
×
MSDS (PDF)
×