Recombinant Human ZNF674 Protein

Recombinant Human ZNF674 Protein
SKU
ASBPP-3566-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q2M3X9

Gene Name: ZNF674

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 55%

Start Site: Lys11

End Site: Gly120

Coverage: 0.20

Isoelectric Point: 4.5

Core Sequence: KDVFVDFTLEEWQQLDSAQKNLYRDVMLENYSHLVSVGHLVGKPDVIFRLGPGDESWMADGGTPVRTCAGEDRPEVWEVDEQIDHYKESQDKFLWQAAFIGKETLKDESG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 55%, Rat - 46%, Pig - 61%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Zinc finger protein 674

Protein name: zinc finger protein 674

Full length: 581 amino acids

Entry name: ZN674_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3566-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3566-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 641339
Product information (PDF)
×
MSDS (PDF)
×