Recombinant Human ZNF675 Protein

Recombinant Human ZNF675 Protein
SKU
ASBPP-3567-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8TD23

Gene Name: ZNF675

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Lys331

End Site: Glu400

Coverage: 0.15

Isoelectric Point: 9

Core Sequence: KRIHTGEKPYKCEECGKAFNRSSKLTEHKNIHTGEQPYKCEECGKAFNRSSNLTEHRKIHTEEKPYKCKE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Rat - 70%, Pig - 68%, Cynomolgus monkey - 100%

Alternative gene names: TIZ

Alternative protein names: Zinc finger protein 675; TRAF6-binding zinc finger protein; TRAF6-inhibitory zinc finger protein

Protein name: zinc finger protein 675

Full length: 568 amino acids

Entry name: ZN675_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3567-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3567-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 171392
Product information (PDF)
×
MSDS (PDF)
×