Recombinant Human ZNF681 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96N22

Gene Name: ZNF681

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 74%

Start Site: Lys401

End Site: Cys480

Coverage: 0.14

Isoelectric Point: 8.5

Core Sequence: KAFNKSSHLTRHKSIHTGEKPYQCEKCGKASNQSSNLTEHKNIHTEEKPYKCEECGKAFNQFSNLTTHKRIHTGEKPYKC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 74%, Rat - 67%, Pig - 72%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Zinc finger protein 681

Protein name: zinc finger protein 681

Full length: 645 amino acids

Entry name: ZN681_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3398-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3398-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 148213