Recombinant Human ZNF684 Protein

Recombinant Human ZNF684 Protein
SKU
ASBPP-3561-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q5T5D7

Gene Name: ZNF684

Expression System: Escherichia coli

Molecular Weight: 18 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Gln11

End Site: Leu140

Coverage: 0.38

Isoelectric Point: 6.5

Core Sequence: QDVAVDFTAEEWQLLDCAERTLYWDVMLENYRNLISVGCPITKTKVILKVEQGQEPWMVEGANPHESSPESDYPLVDEPGKHRESKDNFLKSVLLTFNKILTMERIHHYNMSTSLNPMRKKSYKSFEKCL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Rat - 61%, Pig - 74%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Zinc finger protein 684

Protein name: zinc finger protein 684

Full length: 378 amino acids

Entry name: ZN684_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3561-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3561-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 127396
Product information (PDF)
×
MSDS (PDF)
×