Recombinant Human ZNF692 Protein

Recombinant Human ZNF692 Protein
SKU
ASBPP-3626-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BU19

Gene Name: ZNF692

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Ser121

End Site: Glu190

Coverage: 0.16

Isoelectric Point: 5

Core Sequence: SWGPSLSPTPSEAPKPASLPHTTRRSWCSEATSGQELADLESEHDERTQEARLPRRVGPPPETFPPPGEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Rat - 68%, Pig - 71%, Cynomolgus monkey - 99%

Alternative gene names: AREBP; ZFP692

Alternative protein names: Zinc finger protein 692; AICAR responsive element binding protein

Protein name: zinc finger protein 692

Full length: 519 amino acids

Entry name: ZN692_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3626-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3626-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 55657
Product information (PDF)
×
MSDS (PDF)
×