Recombinant Human ZNF695 Protein

Recombinant Human ZNF695 Protein
SKU
ASBPP-3560-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8IW36

Gene Name: ZNF695

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Thr431

End Site: Ala500

Coverage: 0.15

Isoelectric Point: 9

Core Sequence: TGEKPYKCDECGKAFNWFSYLTNHKRIHTGEKPYKCEECGKAFGQSSHLSKHKTIHTREKPYKCEECGKA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 70%, Pig - 77%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 695; Zinc finger protein SBZF3

Protein name: zinc finger protein 695

Full length: 515 amino acids

Entry name: ZN695_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3560-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3560-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 57116
Product information (PDF)
×
MSDS (PDF)
×