Recombinant Human ZNF696 Protein

Recombinant Human ZNF696 Protein
SKU
ASBPP-3544-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H7X3

Gene Name: ZNF696

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 59%

Start Site: Gly131

End Site: Thr230

Coverage: 0.29

Isoelectric Point: 9

Core Sequence: GRSFKCSSDAAKHRSIHSGEKPYECSDCGKAFIHSSHVVRHQRAHSGERPYACAECGKAFGQSFNLLRHQRVHTGEKPYACADCGKAFGQRSDAAKHRRT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 59%, Rat - 59%, Pig - 83%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 696

Protein name: zinc finger protein 696

Full length: 374 amino acids

Entry name: ZN696_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3544-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3544-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 79943
Product information (PDF)
×
MSDS (PDF)
×