Recombinant Human ZNF699 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q32M78

Gene Name: ZNF699

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 48%

Start Site: Gln11

End Site: Gln110

Coverage: 0.18

Isoelectric Point: 4.5

Core Sequence: QKNRIQDSVVFEDVAVDFTQEEWALLDLAQRNLYRDVMLENFQNLASLGYPLHTPHLISQWEQEEDLQTVKRELIQGIFMGEHREGFETQLKTNESVASQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 48%, Rat - 42%, Pig - 78%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Zinc finger protein 699; Hangover homolog

Protein name: zinc finger protein 699

Full length: 642 amino acids

Entry name: ZN699_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3477-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3477-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 374879