Recombinant Human ZNF70 Protein

Recombinant Human ZNF70 Protein
SKU
ASBPP-3518-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UC06

Gene Name: ZNF70

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 30%

Start Site: Leu31

End Site: Thr120

Coverage: 0.21

Isoelectric Point: 4

Core Sequence: LGDPFLQERGLEQMAVIYKEIPLGEQDEENDDYEGNFSLCSSPVQHQSIPPGTRPQDDELFGQTFLQKSDLSMCQIIHSEEPSPCDCAET

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 30%, Rat - 33%, Pig - 86%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Zinc finger protein 70; Zinc finger protein N27C7-1

Protein name: zinc finger protein 70

Full length: 446 amino acids

Entry name: ZNF70_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3518-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3518-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7621
Product information (PDF)
×
MSDS (PDF)
×