Recombinant Human ZNF705B Protein

Recombinant Human ZNF705B Protein
SKU
ASBPP-3614-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P0CI00

Gene Name: ZNF705B

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 37%

Start Site: Asp11

End Site: Thr130

Coverage: 0.43

Isoelectric Point: 5.5

Core Sequence: DVAIDFTQEEWDMMDTSKRKLYRDVMLENISHLVSLGYQISKSYIILQLEQGKELWWEGRVFLQDQNPDRESALKKKHMISMHPIIRKDTSTSMTMENSLILEDPFEYNDSGEDCTHSST

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 37%, Rat - 59%, Pig - 64%, Cynomolgus monkey - 87%

Alternative gene names: /

Alternative protein names: Putative zinc finger protein 705B

Protein name: zinc finger protein 705B

Full length: 300 amino acids

Entry name: Z705B_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3614-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3614-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 100132396
Product information (PDF)
×
MSDS (PDF)
×