Recombinant Human ZNF705D Protein

Recombinant Human ZNF705D Protein
SKU
ASBPP-3549-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P0CH99

Gene Name: ZNF705D

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Asp11

End Site: Gly140

Coverage: 0.47

Isoelectric Point: 6

Core Sequence: DVAIDFTQEEWDMMDTSKRKLYRDVMLENISHLVSLGYQISKSYIILQLEQGKELWREGRVFLQDQNPDRESALKKKHMISMHPIIRKDASTSMTMENSLILEDPFEYNDSGEDCTHSSTITQCLLTHSG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 59%, Pig - 63%, Cynomolgus monkey - 88%

Alternative gene names: /

Alternative protein names: Zinc finger protein 705D

Protein name: zinc finger protein 705D

Full length: 300 amino acids

Entry name: Z705D_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3549-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3549-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 728957
Product information (PDF)
×
MSDS (PDF)
×