Recombinant Human ZNF707 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96C28

Gene Name: ZNF707

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 56%

Start Site: Thr141

End Site: Gly210

Coverage: 0.22

Isoelectric Point: 10.5

Core Sequence: TDAKPTAFPCQVLTQRCGRRPGRRERRKQRAVELSFICGTCGKALSCHSRLLAHQTVHTGTKAFECPECG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 56%, Rat - 55%, Pig - 59%, Cynomolgus monkey - 89%

Alternative gene names: /

Alternative protein names: Zinc finger protein 707

Protein name: zinc finger protein 707

Full length: 371 amino acids

Entry name: ZN707_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-352-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-352-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 286075