Recombinant Human ZNF709 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N972

Gene Name: ZNF709

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Asn361

End Site: Ser460

Coverage: 0.16

Isoelectric Point: 8.5

Core Sequence: NGPYKCKECGKAFDCPSSFQIHERTHTGEKPYECKQCGKAFSCSSSFRMHERTHTGEKPHECKQCGKAFSCSSSVRIHERTHTGEKPYECKQCGKAFSCS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 73%, Pig - 76%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 709

Protein name: zinc finger protein 709

Full length: 641 amino acids

Entry name: ZN709_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3380-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3380-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 163051