Recombinant Human ZNF71 Protein

Recombinant Human ZNF71 Protein
SKU
ASBPP-3519-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NQZ8

Gene Name: ZNF71

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 36%

Start Site: Ser11

End Site: Arg170

Coverage: 0.34

Isoelectric Point: 7

Core Sequence: SEDKLSVVGEATGGPTRNGARGPGSEGVWEPGSWPERPRGDAGAEWEPLGIPQGNKLLGGSVPACHELKAFANQGCVLVPPRLDDPTEKGACPPVRRGKNFSSTSDLSKPPMPCEEKKTYDCSECGKAFSRSSSLIKHQRIHTGEKPFECDTCGKHFIER

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 36%, Rat - 46%, Pig - 49%, Cynomolgus monkey - 91%

Alternative gene names: EZFIT

Alternative protein names: Endothelial zinc finger protein induced by tumor necrosis factor alpha; Zinc finger protein 71

Protein name: zinc finger protein 71

Full length: 489 amino acids

Entry name: ZNF71_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3519-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3519-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 58491
Product information (PDF)
×
MSDS (PDF)
×