Recombinant Human ZNF71 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NQZ8

Gene Name: ZNF71

Expression System: Escherichia coli

Molecular Weight: 19.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 36%

Start Site: Ser11

End Site: Arg170

Coverage: 0.34

Isoelectric Point: 7

Core Sequence: SEDKLSVVGEATGGPTRNGARGPGSEGVWEPGSWPERPRGDAGAEWEPLGIPQGNKLLGGSVPACHELKAFANQGCVLVPPRLDDPTEKGACPPVRRGKNFSSTSDLSKPPMPCEEKKTYDCSECGKAFSRSSSLIKHQRIHTGEKPFECDTCGKHFIER

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 36%, Rat - 46%, Pig - 49%, Cynomolgus monkey - 91%

Alternative gene names: EZFIT

Alternative protein names: Endothelial zinc finger protein induced by tumor necrosis factor alpha; Zinc finger protein 71

Protein name: zinc finger protein 71

Full length: 489 amino acids

Entry name: ZNF71_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3519-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3519-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 58491