Recombinant Human ZNF714 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96N38

Gene Name: ZNF714

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Pro451

End Site: Gln530

Coverage: 0.15

Isoelectric Point: 9

Core Sequence: PYKCEECGKAFNRSSNLTKHNIIHTGEKSYKCEECGKAFNQSSTLTKHRKIQQGMVAHACNPNTLRGLGEQIARSGVQDQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 70%, Pig - 65%, Cynomolgus monkey - 86%

Alternative gene names: /

Alternative protein names: Zinc finger protein 714

Protein name: zinc finger protein 714

Full length: 554 amino acids

Entry name: ZN714_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3540-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3540-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 148206