Recombinant Human ZNF721 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TF20

Gene Name: ZNF721

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: His171

End Site: Lys240

Coverage: 0.09

Isoelectric Point: 10

Core Sequence: HKRIHNREKAYTGEDRDRAFGWSTNLNEYKKIHTGDKPYKCKECGKAFMHSSHLNKHEKIHTGEKPYKCK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Rat - 55%, Pig - 60%, Cynomolgus monkey - 78%

Alternative gene names: KIAA1982

Alternative protein names: Zinc finger protein 721

Protein name: zinc finger protein 721

Full length: 911 amino acids

Entry name: ZN721_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3569-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3569-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 170960