Recombinant Human ZNF723 Protein

Recombinant Human ZNF723 Protein
SKU
ASBPP-3571-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P0DPD5

Gene Name: ZNF723

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Ser211

End Site: Thr280

Coverage: 0.15

Isoelectric Point: 9

Core Sequence: SVPSKLNNHKRIHTGEKPYKCEECGKAFNVSSSLNNHKRIHTGEKPYKCEECGKTFNMFSSLNNHKRIHT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 66%, Pig - 71%, Cynomolgus monkey - 83%

Alternative gene names: /

Alternative protein names: Zinc finger protein 723

Protein name: zinc finger protein 723

Full length: 513 amino acids

Entry name: ZN723_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3571-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3571-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 646864
Product information (PDF)
×
MSDS (PDF)
×