Recombinant Human ZNF724 Protein

Recombinant Human ZNF724 Protein
SKU
ASBPP-3572-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A8MTY0

Gene Name: ZNF724

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Ile331

End Site: Gly400

Coverage: 0.13

Isoelectric Point: 9

Core Sequence: IHTGDKPYKCEECGKAFNVSSTLTQHKRIHTGEKPYKCEECGKAFNVSSTLTQHKRIHTGEKPYKCEECG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Rat - 68%, Pig - 73%, Cynomolgus monkey - 100%

Alternative gene names: ZNF724P

Alternative protein names: Zinc finger protein 724

Protein name: zinc finger protein 724

Full length: 619 amino acids

Entry name: ZN724_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3572-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3572-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 440519
Product information (PDF)
×
MSDS (PDF)
×