Recombinant Human ZNF732 Protein

Recombinant Human ZNF732 Protein
SKU
ASBPP-3576-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: B4DXR9

Gene Name: ZNF732

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 63%

Start Site: His241

End Site: Glu310

Coverage: 0.13

Isoelectric Point: 9.5

Core Sequence: HKVHTGEKSYKYEECGKAFNRSSTLTKHKRIHAEEKPFTCEECGKIITSSSNVAKHKKIHTGEKLYKCQE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 63%, Rat - 56%, Pig - 59%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Zinc finger protein 732

Protein name: zinc finger protein 732

Full length: 585 amino acids

Entry name: ZN732_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3576-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3576-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 654254
Product information (PDF)
×
MSDS (PDF)
×