Recombinant Human ZNF738 Protein

Recombinant Human ZNF738 Protein
SKU
ASBPP-3580-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8NE65

Gene Name: ZNF738

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Val11

End Site: Ser110

Coverage: 0.30

Isoelectric Point: 6

Core Sequence: VKGASGYPGAERNLLEYSYFEKGPLTFRDVVIEFSQEEWQCLDTAQQDLYRKVMLENFRNLVFLGIDVSKPDLITCLEQGKDPWNMKRHSMVATPPVTYS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Rat - 50%, Pig - 71%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Zinc finger protein 738

Protein name: zinc finger protein 738

Full length: 375 amino acids

Entry name: ZN738_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3580-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3580-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 148203
Product information (PDF)
×
MSDS (PDF)
×