Recombinant Human ZNF738 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NE65

Gene Name: ZNF738

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: Val11

End Site: Ser110

Coverage: 0.30

Isoelectric Point: 6

Core Sequence: VKGASGYPGAERNLLEYSYFEKGPLTFRDVVIEFSQEEWQCLDTAQQDLYRKVMLENFRNLVFLGIDVSKPDLITCLEQGKDPWNMKRHSMVATPPVTYS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Rat - 50%, Pig - 71%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Zinc finger protein 738

Protein name: zinc finger protein 738

Full length: 375 amino acids

Entry name: ZN738_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3580-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3580-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 148203