Recombinant Human ZNF74 Protein

Recombinant Human ZNF74 Protein
SKU
ASBPP-10423-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q16587

Gene Name: ZNF74

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: Arg201

End Site: Glu280

Coverage: 0.13

Isoelectric Point: 9

Core Sequence: RKNVQATEGRTKAPARLCAGENASTPSEPEKFPQVRRQRGAGAGEGEFVCGECGKAFRQSSSLTLHRRWHSREKAYKCDE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Rat - 62%, Pig - 57%, Cynomolgus monkey - 52%

Alternative gene names: ZNF520

Alternative protein names: Zinc finger protein 74; Zinc finger protein 520; hZNF7

Protein name: zinc finger protein 74

Full length: 644 amino acids

Entry name: ZNF74_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10423-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10423-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 7625
Product information (PDF)
×
MSDS (PDF)
×