Recombinant Human ZNF740 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NDX6

Gene Name: ZNF740

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Ala21

End Site: Glu130

Coverage: 0.61

Isoelectric Point: 9.5

Core Sequence: AASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSDKSRSRKDDDSLSEASHSKKTVKKVVVVEQNGSFQVKIPKNFVCEHCFGAFRSSYHLKRHILIHTGEKPFE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 46%, Pig - 98%, Cynomolgus monkey - 98%

Alternative gene names: TB7

Alternative protein names: Zinc finger protein 740; OriLyt TD-element-binding protein 7

Protein name: zinc finger protein 740

Full length: 193 amino acids

Entry name: ZN740_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3582-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3582-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 283337