Recombinant Human ZNF761 Protein

Recombinant Human ZNF761 Protein
SKU
ASBPP-3491-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86XN6

Gene Name: ZNF761

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Arg11

End Site: Asp170

Coverage: 0.23

Isoelectric Point: 6.5

Core Sequence: RDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCTMKEFLSTAQGNREVFHAGTLQIHESHHNGDFCYQDVDKDIHDYEFQWQEDERNGHEAPMTKIKKLTGITERYDQSHARNKPIKDQLGSSFHSHLPEMHIFQTEEKIDNQVVKSVHD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 70%, Pig - 47%, Cynomolgus monkey - 87%

Alternative gene names: KIAA2033

Alternative protein names: Zinc finger protein 761

Protein name: zinc finger protein 761

Full length: 746 amino acids

Entry name: ZN761_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3491-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3491-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 388561
Product information (PDF)
×
MSDS (PDF)
×