Recombinant Human ZNF77 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q15935

Gene Name: ZNF77

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 40%

Start Site: Pro141

End Site: His240

Coverage: 0.18

Isoelectric Point: 9

Core Sequence: PSECTKCGKAFENRQRSHTGQRPCKECGQACSCLSCQSPPMKTQTVEKPCNCQDSRTASVTYVKSLSSKKSYECQKCGKAFICPSSFRGHVNSHHGQKTH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 40%, Rat - 40%, Pig - 57%, Cynomolgus monkey - 87%

Alternative gene names: /

Alternative protein names: Zinc finger protein 77; ZNFpT1

Protein name: zinc finger protein 77

Full length: 545 amino acids

Entry name: ZNF77_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3394-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3394-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 58492