Recombinant Human ZNF771 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q7L3S4

Gene Name: ZNF771

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Glu31

End Site: Ala130

Coverage: 0.35

Isoelectric Point: 8

Core Sequence: EEKYEVVKLKIPMDNKEVPGEAPAPSADPARPHACPDCGRAFARRSTLAKHARTHTGERPFGCTECGRRFSQKSALTKHGRTHTGERPYECPECDKRFSA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Rat - 55%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 771; Mesenchymal stem cell protein DSC43

Protein name: zinc finger protein 771

Full length: 317 amino acids

Entry name: ZN771_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3494-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3494-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 51333