Recombinant Human ZNF772 Protein

Recombinant Human ZNF772 Protein
SKU
ASBPP-3495-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q68DY9

Gene Name: ZNF772

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: His241

End Site: Met320

Coverage: 0.16

Isoelectric Point: 8.5

Core Sequence: HAPHNEWKPHSNTKCEEASHCGKRHYKCSECGKTFSRKDSLVQHQRVHTGERPYECGECGKTFSRKPILAQHQRIHTGEM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 67%, Pig - 78%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Zinc finger protein 772

Protein name: zinc finger protein 772

Full length: 489 amino acids

Entry name: ZN772_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3495-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3495-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 400720
Product information (PDF)
×
MSDS (PDF)
×