Recombinant Human ZNF776 Protein

Recombinant Human ZNF776 Protein
SKU
ASBPP-3497-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q68DI1

Gene Name: ZNF776

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 60%

Start Site: His331

End Site: Thr420

Coverage: 0.19

Isoelectric Point: 10

Core Sequence: HKRSLVHHQRVHTGERPYQCGECGKSFNHKCNLIQHQRVHTGERPFECTACGKLFRSNSHLKEHQRVHTGERPYECKECRKSFRYKSHLT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 60%, Rat - 59%, Pig - 62%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Zinc finger protein 776

Protein name: zinc finger protein 776

Full length: 518 amino acids

Entry name: ZN776_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3497-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3497-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 284309
Product information (PDF)
×
MSDS (PDF)
×