Recombinant Human ZNF780B Protein

Recombinant Human ZNF780B Protein
SKU
ASBPP-3542-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6R6

Gene Name: ZNF780B

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Asn571

End Site: Phe650

Coverage: 0.11

Isoelectric Point: 10.5

Core Sequence: NLNQHRSIHTGKKPFECKECGKAFRLHMHLIRHQKFHTGEKPFECKECGKAFSLHTQLNHHKNIHTGEKPFKCKECGKSF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 63%, Pig - 66%, Cynomolgus monkey - 98%

Alternative gene names: ZNF779

Alternative protein names: Zinc finger protein 780B; Zinc finger protein 779

Protein name: zinc finger protein 780B

Full length: 833 amino acids

Entry name: Z780B_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3542-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3542-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 163131
Product information (PDF)
×
MSDS (PDF)
×