Recombinant Human ZNF782 Protein

Recombinant Human ZNF782 Protein
SKU
ASBPP-3498-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZMW2

Gene Name: ZNF782

Expression System: Escherichia coli

Molecular Weight: 29.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Gln11

End Site: Glu250

Coverage: 0.35

Isoelectric Point: 7

Core Sequence: QDVTVEFSQEEWQHMGPVERTLYRDVMLENYSHLVSVGYCFTKPELIFTLEQGEDPWLLEKEKGFLSRNSPEDSQPDEISEKSPENQGKHLLQVLFTNKLLTTEQEISGKPHNRDINIFRARMMPCKCDIAGSACQGLSLMAPHCQYSKEKAHERNVCDKWLISIKDGRTNTQEKSFAYSKIVKTLHHKEEVIQHQTIQTLGQDFEYNESRKAFLEKAALVTSNSTHPKGKSYNFNKFGE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 69%, Pig - 69%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: Zinc finger protein 782

Protein name: zinc finger protein 782

Full length: 699 amino acids

Entry name: ZN782_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3498-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3498-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 158431
Product information (PDF)
×
MSDS (PDF)
×