Recombinant Human ZNF784 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NCA9

Gene Name: ZNF784

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Val181

End Site: His270

Coverage: 0.29

Isoelectric Point: 10.5

Core Sequence: VVMAAAAAGAAVGKPFACRFCAKPFRRSSDMRDHERVHTGERPYHCGICGKGFTQSSVLSGHARIHTGERPFRCTLCDRTFNNSSNFRKH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 53%, Pig - 98%, Cynomolgus monkey - 59%

Alternative gene names: /

Alternative protein names: Zinc finger protein 784

Protein name: zinc finger protein 784

Full length: 323 amino acids

Entry name: ZN784_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3500-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3500-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 147808