Recombinant Human ZNF789 Protein

Recombinant Human ZNF789 Protein
SKU
ASBPP-3590-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q5FWF6

Gene Name: ZNF789

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: Arg241

End Site: Glu310

Coverage: 0.19

Isoelectric Point: 10

Core Sequence: RSALTVHKQCHLQNKPYRCHDCGKCFRQLAYLVEHKRIHTKEKPYKCSKCEKTFSQNSTLIRHQVIHSGE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Rat - 54%, Pig - 84%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Zinc finger protein 789

Protein name: zinc finger protein 789

Full length: 425 amino acids

Entry name: ZN789_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3590-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3590-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 285989
Product information (PDF)
×
MSDS (PDF)
×